PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0626660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family S1Fa-like
Protein Properties Length: 76aa    MW: 8150.79 Da    PI: 10.6096
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0626660.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA1337.8e-421176570
             S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                        +kG+nPGlivllvv+gl+lvflvgny+ly+yaqk+lPPrkkkP+skkk+k+eklkqG+++PGe
  Lj5g3v0626660.1 11 DSGSKGINPGLIVLLVVAGLVLVFLVGNYVLYIYAQKTLPPRKKKPISKKKMKKEKLKQGISAPGE 76
                     5668*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046896.8E-401376IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MADDVGNGIN DSGSKGINPG LIVLLVVAGL VLVFLVGNYV LYIYAQKTLP PRKKKPISKK  60
KMKKEKLKQG ISAPGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1467661e-126BT146766.1 Lotus japonicus clone JCVI-FLLj-7P11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.12e-26DNA-binding protein S1FA1
SwissprotP425539e-19S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBLI3T2181e-46I3T218_LOTJA; Uncharacterized protein
STRINGPOPTR_0016s08890.13e-17(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355